PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03046.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 1387aa    MW: 150181 Da    PI: 8.5553
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03046.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.7e-13895964148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT......................TTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg......................kgRtlkqcksrwqkyl 48 
                                   rg WT+eEd +l+ +++q+G+++W++I++  g                      + R++k+c++rw +yl
  Zmw_sc03046.1.g00130.1.am.mk 895 RGQWTPEEDNKLLSYITQYGTRNWRLIPKNAGlspanacarqrppshkflpalrLQRCGKSCRLRWTNYL 964
                                   89******************************************************************97 PP

2Myb_DNA-binding42.81.2e-139711013246
                                    SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
               Myb_DNA-binding    2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46  
                                    g +T  E++ +++++   G++ W+ Ia+ ++ gRt++++k++w++
  Zmw_sc03046.1.g00130.1.am.mk  971 GEFTDAEEQTIIKLHSVVGNR-WSVIAAQLP-GRTDNDVKNHWNT 1013
                                    789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF014902.2E-17153234IPR013057Amino acid transporter, transmembrane domain
PfamPF014905.1E-63456766IPR013057Amino acid transporter, transmembrane domain
Gene3DG3DSA:1.10.10.608.5E-23886967IPR009057Homeodomain-like
PROSITE profilePS5129414.07890964IPR017930Myb domain
SuperFamilySSF466891.59E-248921011IPR009057Homeodomain-like
SMARTSM007172.9E-11894966IPR001005SANT/Myb domain
PfamPF002495.2E-12895964IPR001005SANT/Myb domain
CDDcd001675.53E-9898964No hitNo description
PROSITE profilePS5129424.9059651019IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-239681019IPR009057Homeodomain-like
SMARTSM007172.8E-149691017IPR001005SANT/Myb domain
PfamPF002493.5E-129711013IPR001005SANT/Myb domain
CDDcd001671.07E-99721015No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1387 aa     Download sequence    Send to blast
MLPVAKLSFS QREPCGLGNA PELGPDGLCG LRIHPMMIGG PAGSLAPTRP YLAGTRICDT  60
RHNSSPTIFL RSVLSSFAKH QGLDGTEGGR LTPSIDRPAD MALGEGGDHA VTIPLISDQP  120
KHGGIVRSGE REPAARSNLT TDRPGWNSVS DDEGSMWTAA AHVITAVIGS GVLSLAWSIA  180
QLGWVAGPLT MLVFAAVTAL QSTLFADCYR SPDPEHGPHR NRTYAGAVDR NLAKRHPPAH  240
GKDRSPVART RLILVTRQRK GPAPSSDSFR EVGGCSLARV GGRVRVRHRD GAAGTCQVVV  300
GTSSSWVCML LQQTALFGYG IAYTITASIS FSDDVVAPGA ERLLPSRCTG TGELVRRSGG  360
WLRFFPHALA RQPARSGAPL PCHAAKQILY PDKSTGMRCF TLVTCVSVAL LTQCYRHGDL  420
EKGPRNPCYM DAARVYLDIH MLNLLHRTPL PVRMAILKAN CYHDRGHDAP CNYDGNYYML  480
IFGGAQLFLS FIPDFHDMAW LSVVAAVMSF SYAFIGLGLG VANTIANGTI KGSITGVPMR  540
SPVQKVWRVS QAIGDIAFAY PYALILLEIQ DTLKSPPSEN ETMKKASMIS IFVTTFFYLA  600
CGCFGYAAFG SDAPGNLLTG FGFYEPYWLI DFANACIILH LLGGYQVYSQ PIFQFADKFF  660
AERFPDSRFV NDFHAVNFPC LPSCRVNLLR LCFRTLYVAS TTVVAIVFPY FNEVLALLGA  720
LNFWPLAIYF PVEMYFVQRN VPKWSTSIVC LVVSTFALVG AIQGLISQKK YTTTIIPSTQ  780
VVRSDSTAPR SERHGRPVRG MDAWLLGPGV DPALRGWATC PASYGLVTPC AGVEFSIPLM  840
PPSPVPPAAA PIYASAPDRS AAHRRATHGS IDRTPRIRGG EMGRVPCCEK DNVKRGQWTP  900
EEDNKLLSYI TQYGTRNWRL IPKNAGLSPA NACARQRPPS HKFLPALRLQ RCGKSCRLRW  960
TNYLRPDLKH GEFTDAEEQT IIKLHSVVGN RWSVIAAQLP GRTDNDVKNH WNTKLKKKLS  1020
GMGIDPVTHK SFSHLMAEIA TTLAPPQVAH LAEAALGCFK DEMLHLLTKK RPTMPDMAPA  1080
PGAGIGMGIA GGTAAPSFPA QPQADDTIER IKLGLSRAIM NEPGASASDK HQPPWAPVDV  1140
PEGLTGMYAA YDPAQGHENF RYEGTVSEYV LGGGDADQGT SMWSHQSIYS GSSGTEAPRA  1200
ASALPKKGND SVGSSRGEDE MDDSKEGGKG GSDMSGLFGS DCMLWDLPDE LTNHMSWTVN  1260
VEEMLFPSAL FFLENLQYAT SHTLHRTVRK SPAQVHPPPL GDLHREVFCF TISVLHGGGA  1320
APRIGSGGGG GVLPANAALR SFTLVPMGAE PSPRLAQGIN PIRGLNPNLY ACELMTIVIR  1380
EEVSPPR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2889510197108B-MYB
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108673339